Query Sequence
>CA265_RS19580
MSAVEINKDTWLKWFESMLLMRKFEEKTGQLYGQQKIRGFCHLYIGQEAVVAGAISAMQKGDSMITTYRDHAHALALGVSADSIMAEMYGKATGCSKGKGGSMHMFSKEHNFYGGHAIVGGQIPLGAGVAFAEKYKGTDNVNICYMGDGAVRQGALNETFNMAMLWKLPVIFVCENNGYAMGTSVQRTTNMTDIYKIGLGFDMPCAPVDGMDPVAVHNAMDEAIQRARKGEGPTFLEMRTYRYRGHSMSDPAKYRTKEELEDYKAKDPVEHARETILKEKYADQAWIEEVEAKVKAIVDQAVKFAEESPWPDASELYKDVYMQQDYPYVMD
Hit FamilyFIG00053889
Hit Family FunctionPyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)


back to search