Query Sequence
>CA265_RS18930
MPKVITNTSYFQDNEIKSNQDILIEGSTISIINSSENKETSQSLTIPGFIDLQIYGAAGRLFSADPTVESLTIMEDDLLKKGTTGFLACMATNSSEVFNACIKAAKEHRSAAKNCLGLHLEGPFLNPKRLGAHVPAFVRKASLDEIKELIDFGDGVIKMMTIAPEIQDDEVIQYLLDHGVVVSLGHSNATFDEATAAYNKGIQTTTHLFNAMSPIHHREPGIPTAVFNHNKAMASIIADGQHVDFEVLKFAQKLLKERLFLITDAVTACSTGPYQHVEKENKYVMPDGTLSGSSITMLQAVKNCVTHCAISLSDGVKMGTLYPAQLIGIENLTATIATGHQANLLVLDDELSLKEVIFRGETI
Hit FamilyFIG00076542
Hit Family FunctionN-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)


back to search