Query Sequence
>CA265_RS18505
MKKIAIIGSGNIGLSLAKGLVKANYTTTKNIILTRRNTANLYKFAQERYKVTANNADAAADADVIILAVLPQQLNVVLEEIQSAINPAKHLVISVISGVSCAAVREKLDSNVQIIRAMPNTAIAIGQSMTCIASDNASPQNLEDVTRMFETVGSVVKINEDLMTSATALCACGIAFFLRGIRAASQGGVEIGFHADEALKMAVQTAKGAADLLLLHGTHPESEIDKVTSPKGCTIAGLNEMEHNGYSSSLIKGIKLSALKAGNLYTKEG
Hit FamilyFIG00133325
Hit Family FunctionPyrroline-5-carboxylate reductase (EC 1.5.1.2)


back to search