Query Sequence
>CA265_RS18010
MDNSPSKKVWLKFKRNKFAFGGLVFILLLMVMGILGYLIMPDDSPNANVQTLQLNKKKPGSTFTFLIFSRNPKVEKLNFFERMLNGQTPTFKSIPITSYQIKDQAVFVQEYIGDDEKAKETRYELKDLCPSCVLPSKMGTPQALFEKNNIYKQTYILGTDIYGRDLLSRLILGIRVSLSVGLMAVLISLFIGVSLGAIAGYFGGRVDAAISWFMNVVWSLPSLLLVIAISFALGKGFWQIFIAVGLSTWVDVARLVRGQVMALKEVEFVEAARALGFSTSRTIIKHILPNIAGPILVVASSNFASAILLETGLSFLGFGAQPPMPSWGSMIKEHYGYIIMDAAYLAVLPGLAIMFTVYAFNVLAIGLRDAFDVKGQNVTV
Hit FamilyFIG01959358
Hit Family FunctionDipeptide transport system permease protein DppC (TC 3.A.1.5.2)


back to search