Query Sequence
>CA265_RS17585
MEAYIIAGYRTAVGKAPRGVFRFTRADDLAAEVIRALVASVPNLDNEQIDDVIVGNATPEAEQGLNIGRMISLMGLDTDKVPGVTVNRYCASGLDTIATAVAKIKAGMADCIIAGGVEVMSGMPFGGWKLVPNAEVAKNNPDWYWGMGLTAEAVAKEYNVSREDQDAFSLKSHEKAIHAIKNGHLKDGILPITVNENYLDANLKKKTRSYVVDTDEGPRADTTLDKLAKLKPVFDAVGSVTAGNSSQTSDGAAFVLVVSEKKMKELNAEPIARLVSYGIAGVPPRIMGIGPIEAIPKALKQAGLKKEDIDLIELNEAFASQSLAVIRTLDLNPDVINVNGGAIALGHPLGCTGAKLTVQIMNELKRQNKKYGMVTMCVGTGQGAAGIFELL
Hit FamilyFIG01318775
Hit Family Function3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)


back to search