Query Sequence
>CA265_RS16020
MIEIKDIYKSFSGNDVLQGISGKFEEGVTNLIIGGSGSGKTTLLKCMVGLHQPDSGSVLYDGRDFTPMTYEQRIEVRKEIGMLFQGSALFDSMTVEENIMFPLNMFTDQSRKEKLERVDFCLERVNLAGKNKLFPAELSGGMKKRVGIARAISMNPKYLFCDEPNSGLDPKTSIVIDELIQEITEEYKTTTIVVTHDMNSVMGIGDYILFLHEGKKFWEGSNKEIAHTDIKELNDFVFASRFMKAAKDKF
Hit FamilyFIG00006151
Hit Family FunctionMethionine ABC transporter ATP-binding protein


back to search