Query Sequence
>CA265_RS15435
MLHILYIIAITAEAMTAALSAGRRDMDWVGVCIIAWVTALGGGTVRNVLFGHYPMSWVEHPEYLVITAVAALLAAFIASIMTKLKKLFLYLDALGLVVFTIIGCQVAQQIHLPYLIVLFSGMITGCAGGVLRDVLCNEVPFLFRKEIYASAAIVTGAVYIGIEHFHGSEMLATITAAIIGLTLRLLSIRFEWHMPKFVYRDEWH
Hit FamilyNo hits found for this sequence


back to search