Query Sequence
>CA265_RS15340
MHRREALKNVAFLLGGAISASTMGVLFESFTLPENEKNFVLYSLEDEKIFAEFADIIVPTTKSSAGAKAAGLGKFIPMMMKDCYPAAMQTSFAQGFKDLQAKSKKDFGKNYITLTPAERKKLMIDLRAIALAQKESKSEENKDLAYFFITARDLTLLGYYSSEIGCTKAREYVLIPGRYDGNAPLKPGQKSWAT
Hit FamilyNo hits found for this sequence


back to search