Query Sequence
>CA265_RS15165
MKIIAIGRNYAEHAKELNNPVPTTPVIFLKPDTAVLKDNKPFYLPDFSDDVHYELEVVLKICKEGKHIAEKFAANYYDEVGLGIDFTARDIQSKHKEKGLPWELAKAFDNSAPISIFHPKSDFEDLYNLNFELKINGERRQVGHTKDLLFSFEKIISFVSQYITLKKGDLIFTGTPQGVGKINKGDKLEAWLEGKQLLNFDVK
Hit FamilyFIG00007658
Hit Family FunctionFumarylacetoacetate hydrolase family protein


back to search