Query Sequence
>CA265_RS15000
MGLFTKKPMHLLLEEAGDSGKGLKRTLSAGALVALGVGAIIGAGLFVRTAAAAAQNAGPSVTIGFIIAAIGCALAGLCYAELSSSIPISGSAYTYTYATMGELMAWVIGWDLVLEYAVGAATVGIAWSEYLNKLLVEVLHTSPIPYEWCHSPFQSHPDGTVNGIMNLPALFIVGLLSLLLIKGTSESAFVNGLIVITKVGIVILIIVLGWGFINESNHHPYIPAATTYVDHAGISHSFGGFWGVIGAAGTVFFAFIGFDAVSTAAQETKNPKTAMPIGILGSLAVCTVLYILFAHVLTGIAPVEFFRTKGGEASVVAAISEYMTGYSWLSKLVTVAILAGFSSVILVMLLGQSRVFYSMSKDGLLPKMFSDLHPKFKTPYKANLVILIIVGLFAAFIPGDVVGDMTSIGTLFAFMLVCVAVIILRKTDPDLPRQFKTPWVPLIPILGVVACGLMILGLGWTNWLRLFGWLALGFIIYFGYSKKNSHLKDVK
Hit FamilyFIG00957406
Hit Family FunctionCationic amino acid transporter


back to search