Query Sequence
>CA265_RS14660
MKMAAEKLSTRHLLGIKDINRNDIELIFETADNFKEVINRPIKKVPSLRDITIANIFFENSTRTKLSFELAEKRLSADVVNFAASSSSVSKGETLIDTVNNILSMKVDMVVMRHPYAGAGQFLSKHVKAQIVNAGDGAHEHPTQALLDAFSIRQKLGDVAGKKVVIVGDILHSRVAISNILCLQRLGAEVMVCGPTTLIPKHIHQLGVKVEHNLIKALNWCDVANMLRIQLERQDIKYFPSLREYAMMYGLNKQILDNLDKEIIVMHPGPINRGVEITSDVADSKQSIILEQVENGVAVRMAVLYLLASQG
Hit FamilyFIG00000122
Hit Family FunctionAspartate carbamoyltransferase (EC 2.1.3.2)


back to search