Query Sequence
>CA265_RS14515
MKTTQNISHFKQKALHWANQFEVCCFLDSNNYKDAYSAYDFIIAVDADHELKCATGNAFDQLKSFYALHKQWIFGFFGYDLKNEIEDLHSNNSDHLNFPDLYFFVPKYLIAFKKGNAEVLIGPESILAEIDSFQLKTEIQSKKAKVAQRLSKDQYVQKVEALRDHIIRGDIYEVNFCQEFFAENAEIDPVQTFEALNSVSPTPFAGYFKVQGNYILSATPERFLCKRGSKLTSQPIKGTAKRSLDPMEDEAIKLQLRNDIKEQAENVMIVDLVRHDLTKSAVKGSVTVDELFGIYSFPQVHQMISTISCELNPAIHFIDAIKNAFPMGSMTGAPKVKAMKLIEEYEVTKRGIYSGSFGCISAAGDFDFNVVIRSILYNAASNYLSFQVGGAITYQSNAVLEYEECLLKASAILKVLEG
Hit FamilyFIG01960215
Hit Family FunctionPara-aminobenzoate synthase, aminase component (EC 2.6.1.85)


back to search