Query Sequence
>CA265_RS14425
MFEEIYSPVQKITFAPFNNLFVKRDDLIDPYISGNKWRKLKYILARAKAAHKSHLVTFGGAYSNHLVATAAAASRSGLTATAFVRGEEVKNELLLLCRLFGMKLIFTDRESYRDKQKLFQQHFGNDQQAYFIDEGGASAEATTGCAEVISELTETYDHIFCAAGTGTTAAGLLNGIQQQGLSTKLHIIPVLKGGLFIKDEIAKYTPLSNHLELHLDYHFGGYAKTTPELISFIKTFTSKTGLLLDPVYTGKMFYAIQDLVKQGIIGKDEKVLAIHTGGLMGIFGMKDKF
Hit FamilyFIG01962700
Hit Family Function1-aminocyclopropane-1-carboxylate deaminase (EC 3.5.99.7)


back to search