Query Sequence
>CA265_RS13790
MKIAFKMKLKPGFETEYKKRHDEIWPELSTLLKENGISDYSIFLDEETNTLFAVQQQNGSSSQDLGSTRIVQKWWAYMADIMETNADNSPKTFPLEMVFHLD
Hit FamilyFIG00001862
Hit Family FunctionL-rhamnose mutarotase


back to search