Query Sequence
>CA265_RS12250
MKITNVEAFWLRCPIPEAKQHVSDYGLLTSFDMTLVVITTDSGLQGFGEAKAAVGSCGICASIVNCIENELKPMLLGKSVKNITRLWEEMYNGTRDHYALSRGRKFPILGRRGLTISAMSGIDTALWDLKGKMLNVPVADLLGGACRTKMPAYASGGWADEQNIGEQLMGYVNKGFKGVKMRVGVMDDTVQKSINRVKAARAALGPDIKLMVDAHGTFSVPEAKQFCRGVEDCNVYWFEEPISPDNRKGTAEVRAATDIPIAAGESEFTSFDIHDLLQIRAIDVVQPDAAIIGGISEAMRVSHLASVHQVELAPHCWGSAFSFMAGLTVAFASASATIIEFSLGGNPMMYDLVNEQIAVVNGEISAPTAPGLGLTPNWDFVKQFKQSV
Hit FamilyFIG01382484
Hit Family FunctionL-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily


back to search