Query Sequence
>CA265_RS10200
MKQGLLIDMDGVIYSGEELIFGADKFIKNLIDEDIPFAFMTNNSQRTALEVVRKLKGLGIKVEESHVYTSAMATGKFLSDQSPAGTAYVLGEGGLLSSLHDHGITLVNTDPEFVVLGEGRNFTLEMVQRAVDMILAGAKFITTNRDPSPKKPGWNNLGIAATTAMIEEATGRKAFVTGKPSPVMMRSARKFLGLETSETTVIGDTMETDIQGGVQMGYKTILVLSGISSKDTLGHYAFKPDMIASSVDEIKFPLAWWEDK
Hit FamilyFIG01300296
Hit Family FunctionPyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), eukaryotic type


back to search