Query Sequence
>CA265_RS09870
MKSSDQKPNQGDSRRDFLKKSSVITAIALTPGVAVKAAESNADERFAELFEKIPLKLTVNNKAYQTTVEPRVTLLDYLREELHLTGTKKGCDHGQCGACTVHVDGQRVNSCLSLAVMNEGKKITTIEGLANGDTLHPMQAAFIKHDGFQCGYCTPGQIMSAVACVREGHTGSRAEISEYMSGNICRCGAYPNIVDAIIEVKEGGETV
Hit FamilyFIG00801385
Hit Family FunctionPeriplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT


back to search