Query Sequence
>CA265_RS09010
MKILANDGIDPIGKELLEKAGFQVDTETVPQDQLAEALKNYDAITVRSATKVRKELIDAVPNIKLIGRGGVGMDNIDVEYARSQGINVVNTPAASSLSVAELVFSHLFTGIRFLQDANRKMPVEGSTQFNNLKKAYAKGTELSGKTIGIIGFGRIGRATAKVALGLGMNVLAYDLYPSESEITLEFQGGKSVSIPIKTVSLDEVITGSDFFSLHTPFADKPILGAEEFAKMKNGVGIVNCSRGGTIDELALIDALNSGKVSFAGLDVFDNEPTPLAEILTHPKISLTPHIGASTNEAQERIGTELATLIIEHFKK
Hit FamilyFIG00031250
Hit Family FunctionD-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)


back to search