Query Sequence
>CA265_RS08895
MNKDYYALIMAGGVGSRFWPVSRTEYPKQFIDFFGVGKTLIQSTYDRFLKICLPENIFIVTNEIYSDLVKEQLPQLSANQILAEPLLRNTAPCIAYGSLKIAQLNPNATIVVAPSDHTIANIDGFIESIQQSLDAASKNDCLITLGIKPNRPDTGYGYIQHTDYVLNTDTDLHKVKTFTEKPNLELAKSFLQSGDFLWNAGIFIWSAKAILSAFEKHLPDMYEIFNIGRSELNTEGEKAFINNAYFQCTNISIDFGIMEKAENVYVLPSDFGWSDLGTWASIYEMAEKDYVGNAVIPSEQVLMFDSSNCMVNVPKDKLVILQGLHDYIVVENNNMLMICPRNEEQRVKEFVAEVKSRYGNKFI
Hit FamilyFIG01956356
Hit Family FunctionMannose-1-phosphate guanylyltransferase (GDP) (EC 2.7.7.22)


back to search