Query Sequence
>CA265_RS08355
MFSLKNKKAVVTGGGSGIGKAIATILAKQGAEVHIIELGTEHAQDTLDEIKTNGGVAFSYGCDVSDHQAVAAVFNEIGNINILINNAGIAHIGKADTTDEADFDRVMRVNVKGVYNCLHAAIPQIRLSGGGVIINMASIAALIGLPDRFVYSAAKGAVKAITMSVAKDYIGENIRCNSISPARVHTPFVDGFLQKNYPDNIPEMFEKLSKTQPIGRMAKPEEVGALALYLCSDEASFITGCDYPIDGGFTTLNN
Hit FamilyFIG01151414
Hit Family FunctionD-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)


back to search