Query Sequence
>CA265_RS08340
MIDTHVHFWNFDPVRDSWINEEMPAIRHDFSPKDLTAVYHDLQITGCIAVQASQSEEENRFLLSLAEENEMVKGIVGWVDLLDPNLDERLTYWSNFKKIKGWRHILQAENADFILNKKFIAGVNLLKKYHYTYDLLCYHDQLADIIKMVDQIPDQPFVLDHCGKPDVKSQEIKSWSENIKILAANPNVLCKVSGLLTEADWKKWTEKELFNCFDVVFEHFGTERIMYGSDWPVVLLSRPYQDWFNLVTKYTGQFSAAEKKLIFSDNAKAFYGV
Hit FamilyFIG00002801
Hit Family FunctionL-fuconolactone hydrolase


back to search