Query Sequence
>CA265_RS07515
MTKLGRELASKGINIISLSVGEPDFNTPDHVKNAAKKALDENYTRYSPVPGYPDLRQAIVNKLKTENNLDYDISQIVVSTGAKQSLSNVILTLIDPDDEVIIPTPYWVSYSEMVTLAEGKSVFIDTDIESDFKITPAQLEAAITPKSKLFMFSSPCNPTGSVYSKEELAALVAVFEKHPNIYILSDEIYEHINFVDKHESIAQFDSIKDRVIIVNGFSKAFAMTGWRLGYIAANKEIAAANDKLQGQTTSGTCSIAQRAGIVAYEQGLASVLEMKEAFLRRRELVYNLLNEIPGVKTNLPDGAFYFFPEISSFFGKKDADGNVIKDSSDLALYLLNVGHVATVGGDSFGNNNYIRLSYAASDESLVEALRRIKEALGKLA
Hit FamilyFIG00719736
Hit Family FunctionAspartate aminotransferase (EC 2.6.1.1)


back to search