Query Sequence
>CA265_RS07485
MEKPLITIKEIGRKYVIGSEVIHALKSVSLDINKGEFVALMGPSGSGKSTLMNILGCLDTPSSGTYVLNGTNVSHMSDDALAEVRNQEIGFVFQTFNLLPRSTSLDNVALPLIYAGTSKKDRDARAARALENVGLGNRMDHKPNELSGGQRQRVAVARALINNPSIILADEPTGNLDTKTSIEIMGLLEEIHSKGNTIILVTHEEDIAQHAHRIVRMRDGLIENDYLNTDIKNVSPRLQALKDNGSDWEKIN
Hit FamilyFIG00040248
Hit Family FunctionATPase component BioM of energizing module of biotin ECF transporter


back to search