Query Sequence
>CA265_RS06590
MKEVVIVSAVRTPIGSFGGSLAQFSATQLGGFAIKAAIEKAGLKPEQIQEVYMGNVLSANLGQAPATQAAKFAGLPDLPATTINKVCASGTKAIMLAAQSIANGDNEIIVAGGMESMSNVPYYLDKARNGYRLGHGQITDGLVKDGLWDVYNDYHMGSAAELCATECNINREAQDNFAISSYKRAQAAQTSGKFANEIVAIEVKDRKGDITLVDTDDEPTAVKFDKIPSLKPVFKKDGTVTAANASTLNDGAAALVLMSADKAKELGLTPLAKILGYADAQQAPEWFTTAPSKAIPLALHKANVNINDVDFFEINEAFAVVSIANNQLLALNDNQVNVNGGAVSLGHPLGASGARIVVTLLSVLAQNDGKIGVAGICNGGGGASALVIGKL
Hit FamilyFIG00002604
Hit Family FunctionAcetyl-CoA acetyltransferase (EC 2.3.1.9)


back to search