Query Sequence
>CA265_RS06310
MFSKEEIAQRIAKEIKDGYYVNLGIGIPTLVANYIPKGINVVLQSENGLLGMGPFPFEGEEDADLINAGKQTITTLPGSSIFDSAMSFGMIRAQKVDLTILGAMEVSENGDIANWKIPGKMVKGMGGAMDLVASAKNIIVAMQHINKAGESKLLPKCTLPLTGVKCIKKIVTELAVLDILPEGGFKLLERAPGVSIEFIQQSTAGRLIIEGDIPEMRLD
Hit FamilyFIG00133276
Hit Family FunctionSuccinyl-CoA:3-ketoacid-coenzyme A transferase subunit B (EC 2.8.3.5)


back to search