Query Sequence
>CA265_RS06305
MINKVVSGAEEAIKDISDGVTLMLGGFGLCGIPENCIKALVNKQVKNLTCISNNAGVDDFGIGLMLKQRQVKKMISSYVGENAEFERQLLSGELEVDLIPQGTLATRCLAAGYGMPAIFTPAGVGTEVAEGKEIRNFDGKDYLMEYAFDADFAIVKAWKGDTAGNLIFRSTSRNFNPVMAMAGKITIAEVEELVEAGELDPDYIHTPGIYVHRIFQGKDYEKRIEQRTVRKSEV
Hit FamilyFIG00133228
Hit Family FunctionSuccinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)


back to search