Query Sequence
>CA265_RS04675
MSHTPSTNFQVSDTPKNGKGYLFPLILVTSLFFFWGFVHNLDPVLIPHLRKAFQLNVFESTLVDSSVFIAYFLLALPAGYIMRKYGYKSGIILGLVLFAIGCLLFIPAANTAQYIFFLGALFIIACGLTFLETAANPYVTVLGPPETATQRLNFSQSFNGLAAFLAPVLGGKFIFTEVKYTDAQLAKMLPLEKQAYMLEEASTVKAPYLILGILIIVVAILFIFTKLPDIKEEENAQEKSSFSHVLGHSHLRWAIIGQFFYVGAQVCVLSLFISFVTSSAGISQDAAKWYAGAAGLAFMVGRFAGTFFMRYVAAHKLLMLYALISAVLTLVSIFASGMITVYALIGVSFFMSIMFPTIFSLGIAGLGKDTKLGSSLIVMSIVGGAFLPPVLGLISDATHNIQYGYLVPFVCFLVVFYFGWKGWKPNHIEKEISLEV
Hit FamilyFIG00003949
Hit Family FunctionFucose permease


back to search