Query Sequence
>CA265_RS03080
MKVTVVGAGAVGATCADNIARKELANELVLLDIKEGFAEGKAIDMMQTATLLGFDTKITGVTGDYSKTAGSDVVVITSGLPRKPGMTREELIGINAGIVKGVAENILKFSPEAIFIVISNPMDTMTYLALKSLGLPKNRIIGMGGTLDSSRFKFYLSQALNCNPNDLQGFVIGGHGDTTMIPLTRLATYQSLPVSNLLDKATLDKVAADTMVGGATLTGLIGTSAWYAPGAAGAALVEAILRDEKKLFTCCVSLEGEYGQEDICLGVPVIIGRNGWEKIIDFKLTDDEQAAFNKSADAVRNMNSVLAEMKLV
Hit FamilyFIG00000455
Hit Family FunctionMalate dehydrogenase (EC 1.1.1.37)


back to search