Query Sequence
>CA265_RS01140
MESILNIRNVSKIYQSAGRELTVLDNINFSITAGSTVAITGPSGSGKTTLLGLCAGLDRASSGTVELNGIALEKLNEDERAAVRNQYVGFIFQNFQLLPTLTALENVMVPLELRGAKNIRAHALELLDKVGLADRSHHYPVQLSGGEQQRVSLARAFSNQPAILFADEPTGNLDAETSEKVIKLLFDLNKDAGTTLIIVTHDLELAARTARSIKIKGGVIISDENSTYA
Hit FamilyFIG00007923
Hit Family FunctionABC transporter ATP-binding protein YvcR


back to search