Query Sequence
>CA265_RS01080
MNHTKIGWIGLGNMGIPMAEQLINAGYAVMVYNRSKDKEASLKEMGASIAQTPQDLITTTDVVIVMVSDDAAIAQIFNGEGGLLRVETSGKIIINMSTVSPSISKEMAALCKANGNFYLDAPVSGSVKQAETGQLVIMVGGEEDVFNQVKPILEKMGKLAKLVGENGAGNSAKLAINSLLALYAQGLAETVLFANKQGIKTSDLLELINNAAIGNIFTKIKGDAIIADHYKAAFALKHIVKDLNLAKAEGISSPLAKTALNTFGDAAAKYGEEDIIAIIKQLSGN
Hit FamilyFIG00133229
Hit Family Function2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)


back to search