Query Sequence
>BWI76_RS26335
MSQPLLSVNGLMMRFGGLLAVNNVSLELREREIVSLIGPNGAGKTTVFNCLTGFYKPTGGTIMLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGVFSGLLKTPSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGLNPKETKELDELIAELRSHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEEIRNNPDVIRAYLGEA
Hit FamilyFIG00020185
Hit Family FunctionBranched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)


back to search