Query Sequence
>BWI76_RS25335
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMQRIEKDWYSLMNTIQTGTAAQADTARKQLREELQAIAPVFTQKPYFLSDEFSLVDCYLAPLLWRLPVLGVELVGAGAKELKGYMTRVFERDSFLASLTEAEREMRLGRG
Hit FamilyFIG00001437
Hit Family FunctionStringent starvation protein A


back to search