Query Sequence
>BWI76_RS23630
MAIENKVALVTGAGQGIGRGIALRLAKDGASLMLVDVNPEGIAAVAAEVEALGRKAATFVANIADRAQVYAAIDEAEKQLGGFDIIVNNAGIAQVQALADVTPEEVDRIMRINVQGTLWGIQAAAKKFIDRQQKGKIINACSIAGHDGFALLGVYSATKFAVRALTQAAAKEYASRGITVNAYCPGIVGTGMWTEIDKRFAEITGAPVGETYKKYVEGIALGRAETPDDVASLVSYLAGPDSDYVTGQSILIDGGIVYR
Hit FamilyFIG00106599
Hit Family Function2,3-butanediol dehydrogenase, S-alcohol forming, (S)-acetoin-specific (EC 1.1.1.76)


back to search