Query Sequence
>BWI76_RS22920
MGNTTIQTQSFRAVETGKSKRYIIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFVIPIPAGILMKKLSYKAGIITGLFLYAFGAALFWPAAEVMNYTLFLIGLFIIAAGLGCLETAANPFVTVLGPESGGHFRLNLAQTFNSFGAIIAVVFGQSLILSNVPHQSQDVLDKMAPEQLSAYKHSLVLSVQTPYMIIVAVVLLVALLIMLTKFPALQSDDHSDATQSSFSASLARLVRVRHWRWAVLAQFCYVGAQTACWSYLIRYAIEEIPGMTPGFAANYLTGTMVCFFIGRFSGTWLISRFAPHKVLAAYALLSMILCLISAFTGGHVGLLALTLCSAFMSIQYPTIFSLGIKNLGQDTKYGSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELVPALCFAVIFIFARFRSQTAAN
Hit FamilyFIG00003949
Hit Family FunctionFucose permease


back to search