Query Sequence
>BWI76_RS22410
MELEEQVMGIIINAGQSRSLCYEALSCAKAGDFTAADEKMKEAAHFAREAHRVQTQLIEADEGEGKTKMTLVMVHAQDHLMTSILAKELIGELIAIYRSRPLHA
Hit FamilyFIG00011115
Hit Family FunctionPTS system, cellobiose-specific IIA component (EC 2.7.1.69)


back to search