Query Sequence
>BWI76_RS22070
MADQSNPWDTAPAADSAAQSADAWGTSTPAPTNGGSADWLSSAPAPQPEHFNIMDPFHNTLIPLDSWVTHGIDWVVMHFRPLFQGIRVPVDYILSAFQQLLLGMPAPVAIIIFSLIAWQISSVGMGAATLISLIAIGAIGAWSQAMVTLALVLTALLFCMLIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQVPADLIEASRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWYATGPLGLITRPFCK
Hit FamilyFIG00005559
Hit Family FunctionL-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)


back to search