Query Sequence
>BWI76_RS20065
MISLDEAMLYAPIEWQDCSEGYTDIRYQKSADGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIVLTGEGDKAFCAGGDQKVRGDYGGYQDDSGVHHLNVLDFQRQIRTCPKPVLAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP
Hit FamilyFIG00071623
Hit Family FunctionNaphthoate synthase (EC 4.1.3.36)


back to search