Query Sequence
>BWI76_RS17895
MEITLLQIVLVFIVACIAGMESVLDEFQFHRPLVACTLIGAVLGDMKTGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTVLVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAFQHAADKAAENGNLTAISWLHVSSLFLQAMRIAIPAVIVAISVGTSEVQGLLNAIPEVVTGGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTDFNLVALGVIGTVMAVLYIQLSPKYNRVAGAPAQAAGNNDLDNELD
Hit FamilyFIG00011554
Hit Family FunctionPTS system, mannose-specific IIC component


back to search