Query Sequence
>BWI76_RS17240
MTIITKKSLVAAGVLSALMTINAAVAADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNINRDLFEGLLVSDLDGHPVAGVAEKWDNKDFKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRLADPKTASPYASYLQYGHLANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAIEKFGDKWTQPANIVSNGAYKLKDWVVNERIVLERNTNYWDNAKTVINQVTFLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPKEVHVDPYLCTYYYEINNQKAPFTDVRVRTALKMALDRDIIVNKVKNQGDLPAYSYTPPYTDGMKLIEPEWFKWSQEKRNEEAKKLLAEAGYSADKPLTFNLLYNTSDLHKKLAIAVASIWKKNLGVNVKLENQEWKTFLDNRHQGTFDIARAGWCADYNEPTSFLNTMLSDSSNNTSHYKSPAFDKIIAETLKTSDEGKRADLYAQSEQQLDKDSVIVPVFYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
Hit FamilyFIG00432360
Hit Family FunctionOligopeptide ABC transporter, periplasmic oligopeptide-binding protein OppA (TC 3.A.1.5.1)


back to search