Query Sequence
>BWI76_RS16755
MKKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAQAVADEINRSGGRALAVKVDVSQRDQVFAAVEQARKGLGGFDVIVNNAGVAPSTPIEEIREDVIDKVYNINVKGVIWGIQAAVEAFKQEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAHLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTQEFAKRITLGRLSEPEDVAACVSYLAGPDSNYMTGQSLLIDGGMVFN
Hit FamilyFIG00053886
Hit Family Function2,3-butanediol dehydrogenase, S-alcohol forming, (R)-acetoin-specific (EC 1.1.1.4) / Acetoin (diacetyl) reductase (EC 1.1.1.5)


back to search