Query Sequence
>BWI76_RS16670
MKKTTLAAGLLALFALSASANETLTVGATPVPHAEILEFVKPELAKQGVDLKIKVFNDFIQPNQQLAEKNLDANYYQYRPFLDNYNQTRHTHLLPVVGVHIEPFGAYSSKYKTIKEVPDGATVAIPNDPVNTGRALVMLSNAGLITLKNPRDPQSATKDITANPHRFKIRELEGAMLARAVNQVDLAFIFANYALEAGIDTDKALLVEKGSDLYVEYLVARPDNINDPGIQKLAKALNSDRVRSFILTRYKGKILPGF
Hit FamilyFIG00047509
Hit Family FunctionMethionine ABC transporter substrate-binding protein


back to search