Query Sequence
>BWI76_RS15930
MSAQYGFFIDSARCTGCKTCELACKDYKNLTPDVSFHRIYEYAGGDWQEDNGVWNQNVFAYYLSIACNHCEDPACTKVCPSGAMHKRDDGFVVVNEEVCIGCRYCHMACPYGAPQYNAAKGHMTKCDGCYDRVADGKKPICVESCPLRALDFGPIEELREKHGQLAAVAPLPSAHFTKPSIVIKPNANSRPTGDTTGYLANPKEV
Hit FamilyFIG00001037
Hit Family FunctionAnaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)


back to search