Query Sequence
>BWI76_RS13135
MRDAFICDGIRTPIGRYGGALASMRADDLAAIPLRELLSRNPKFDPASIDDVILGCANQAGEDNRNVAHMATLLAGYPHTVPGTTVNRLCGSGLDAIGFAARAIKAGEADLMIAGGVESMSRAPFVMGKASAAYQRQAELFDTTIGWRFVNPLMQQRFGTDSMPETAENVAELLNISRADQDAFAYRSQQRSARAQRDGILAQEIVPVPIIGGKGAVSTVYEDEHPRAETTLEQLSRLKTPFRKGGVVTAGNASGVNDGAAALIIASSQQAIAQGLTPRARIVAMATAGVEPKLMGLGPVPAVRKVLERAGLSIKDMDLIELNEAFAAQALGVLRQLGLADDAPHVNPNGGAIALGHPLGMSGARLALSASLELQRRSGRYALCTMCIGVGQGIAMILERV
Hit FamilyFIG01305022
Hit Family FunctionAcetyl-CoA acetyltransferase (EC 2.3.1.9); Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)


back to search