Query Sequence
>BWI76_RS13100
MNNDNPVAAYALRLGDNGLVLAQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGSGDEDTLAFGRNERQFCNLLLAEQPNGNFADTLARQFFIDVWHVALYGRLVSSRDTQLAAIAAKALKEVRYHQRFSRGWLERLGNGTALSAQRMQDAVDNLWRFTGELFQADALEIELSAQGIAVDPRELQAEWQATVRAALSDAGLQIPEEAPFRHGGKQGLHSEHLGPLLAEMQYLQRAYPGQRW
Hit FamilyFIG00001825
Hit Family FunctionPhenylacetate-CoA oxygenase, PaaI subunit


back to search