Query Sequence
>BWI76_RS13095
MSKNDWPLYEVFVRSKQGLSHRHVGSLHAADDQMALENARDAYTRRSEGCSIWVVKAREIVASQPEERGEFFDPAESKIYRHPTFYTVPDGMEHM
Hit FamilyFIG00002137
Hit Family FunctionPhenylacetate-CoA oxygenase, PaaH subunit


back to search