Query Sequence
>BWI76_RS09865
MNYRIIPVTAFAQNCSLIWCEQTKLAALVDPGGDAERIKQEVAAAGVSLMQILLTHGHLDHVGAAAELAQHYGVPIIGPEKEDEFWLEGLPAQSRMFGLEDCQPLQPDRWLNEGDAVSVGNISLQVLHCPGHTPGHVVFFDPACRLLISGDVIFKGGVGRSDFPRGDHNQLIDAIKRKLLPLGDDVSFIPGHGPMSTLGYERLHNPFLQDEMPVW
Hit FamilyFIG00146515
Hit Family FunctionHypothetical metal-binding enzyme, YcbL homolog


back to search