Query Sequence
>BWI76_RS08475
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGAPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAENFIPFLNDHIKPLLEGRDVDTFLPNARFFDKLRIDGHLLHTAVRYGLSQALLDATALASGRLKAEVVCDEWQLPCIPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGLKGEKLREYVRWLSDRILSLRASPRYRPTLHIDVYGTIGLIFDMDPVRCADYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIIDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHAMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQAKD
Hit FamilyFIG00615132
Hit Family FunctionMethylaspartate ammonia-lyase (EC 4.3.1.2)


back to search