Query Sequence
>BWI76_RS08105
MSIDWNWGIFLQQAPFGNTTYLGWLWSGFQVTVTLSVTAWIIAFFVGSLFGILRTVPNRLLSTIGTCYVELFRNVPLIVQFFTWYLVVPELLPENIGMWFKSELDPNIQFFVSSMLCLGLFTAARVCEQVRSGIQSLPRGQKNAGLAMGLTLPQTYRYVLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLADMAAQAGKLLDYSAHAWESFTAITLAYVFINAVIMLIMYVVERKVRLPGNMGGK
Hit FamilyFIG00004494
Hit Family FunctionGlutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)


back to search