Query Sequence
>BWI76_RS06035
MSQKNFVELRNVTKRFGSNMVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIYIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGDNVGYGLKMLGVPRGDVKARVKEALAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIRELQKQFDITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQELYRQPASRFMASFMGDANLFPAAFSEDFVDIYGYRLPRPPHFAAHGEGSVGVRPEAITLSDRGEESQRCTIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDVGEHYYLEIHPYGMFVLADAG
Hit FamilyFIG00450796
Hit Family FunctionABC transporter ATP-binding protein


back to search