Query Sequence
>BWI76_RS04445
MKPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTARLLVHHALQHPLYRDVETVVRINPLNTPFGLADLEAVVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGREVGSTKLMAAIESALGVVNAVEIARSSPRLSAIALAAFDYVMDMGTCRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTLKDVEHARDVIAAAEEAEERGLGVVSLNGKMIDGPIIDHARKVVALSASGIRD
Hit FamilyFIG00010100
Hit Family FunctionCitrate lyase beta chain (EC 4.1.3.6)


back to search